PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 581aa    MW: 62938.8 Da    PI: 4.8851
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016671.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.23.9e-1392165741374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv++L++cAeav++++l+ a+al++++  la+ +  +m+++a+yf+eALa+r++r    +y    p++  +++ s+ l++   f+e++P+lkf+h+ta
  Pbr016671.1 216 LVHTLMACAEAVQQENLKVADALVKHVGLLAAAQTGAMRKVATYFAEALARRIYR----IY----PQDCLDSSYSDILQM--HFYETCPYLKFAHFTA 303
                  689****************************************************....44....444443335555444..5*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIlea+++++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+fef+ +va++l+dle++ L++
  Pbr016671.1 304 NQAILEAFATATRVHVIDFGLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAETIGVEFEFRGFVASSLADLEPSVLDI 401
                  ************************************************************************************************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  +++Ea+aVn+v++lh ll++ +++++    vL+ +k ++Pk+v++veqea+hn++ Fl+rf+eal+yys+lfdsle +  +  +++ ++++++lgr+i
  Pbr016671.1 402 RQDEAVAVNSVFELHGLLARAGAVDK----VLSSIKAMKPKIVTIVEQEANHNGPAFLDRFTEALHYYSSLFDSLEGS--SGPSQDLVMSEVYLGRQI 493
                  ******************88888877....*********************************************999..566999************ PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +nvvaceg +r+erhetl +Wr r+++aGF +v+l+++a kqa++ll+ ++ +dgyrvee++gsl+lgW+++pL+++SaW+
  Pbr016671.1 494 CNVVACEGGDRVERHETLTQWRGRMDSAGFDSVHLGSNAFKQASMLLALFAgVDGYRVEENNGSLMLGWHTQPLIVTSAWK 574
                  ********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.4E-3549121No hitNo description
PfamPF120412.7E-3349113IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.592190553IPR005202Transcription factor GRAS
PfamPF035141.4E-136216574IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MKREHCHSSA TASQNNSKPE YSSPPSSALN GKAKIWVDEQ GYSGSGGMDE LLAVLGYKVR  60
TDDMADVAEK LEQLEMVMGS AQEDGISQLS DTVHYNPSDL SGWVQSMLSE LNTGDDMPSI  120
NGPLLAPGES STRTSTKFCN SQRTRVFNDD SEYDLRAIPG VAAYPPAHSS SETESTRKRL  180
KTSIGSNSGG IEVSGAVSDP TRPLVLVDSQ ETGVQLVHTL MACAEAVQQE NLKVADALVK  240
HVGLLAAAQT GAMRKVATYF AEALARRIYR IYPQDCLDSS YSDILQMHFY ETCPYLKFAH  300
FTANQAILEA FATATRVHVI DFGLKQGMQW PALMQALALR PGGPPAFRLT GIGPPQPDNT  360
DALQQVGWKL AQLAETIGVE FEFRGFVASS LADLEPSVLD IRQDEAVAVN SVFELHGLLA  420
RAGAVDKVLS SIKAMKPKIV TIVEQEANHN GPAFLDRFTE ALHYYSSLFD SLEGSSGPSQ  480
DLVMSEVYLG RQICNVVACE GGDRVERHET LTQWRGRMDS AGFDSVHLGS NAFKQASMLL  540
ALFAGVDGYR VEENNGSLML GWHTQPLIVT SAWKLASSTE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-572165744375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3110020.0KU311002.1 Pyrus pyrifolia cultivar mixueli DELLA protein GAI1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370101.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLQ0HA730.0Q0HA73_MALDO; DELLA protein
STRINGPOPTR_0005s14540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2